Subscribe

Correia Nails It

Correia Nails It

Last Redoubt / November 14, 2016

No comment necessary. No, he’s not a Trump supporter. That said, he doesn’t shoot the wrong way.

It’s also a good overview if you are new to buyig guns, self defense law, etc.

A Handy Guide For Liberals Who Are Suddenly Interested In Gun Ownership

Share Twitter Facebook Google+
Last Redoubt's Picture

About Last Redoubt

Post navigation

Next Post Preview
Next

SJW's and Abusers

November 15, 2016
Previous Post Preview
Previous

Hillary Supporters, Borderlines, Narcissists, and Child Abuse

November 13, 2016

Alt Tech

Infogalactic - the Planetary Logic Core

Infogalactic, Gab, and Helping Out

Friends of

  • Castalia House Publishing
  • John C Wright
  • Bayou Renaissance Man
  • Barbarian Book Club
  • Monster Hunter Nation
  • Brian Niemeier
  • Nick Cole
  • Jon Mollison
  • Vox Populi
  • Armed and Dangerous
  • Jefro’s Space Gaming Blog
  • Didact’s Reach
  • Free Domain Radio
  • Stefan Molyneux BitChute
  • Men of the West
  • Dangerous (Milo)
  • Quintus Curtius
  • Stares at the World
  • The Rageaholic
  • Walker’s Retreat
  • Empires Must Fall
  • Wasteland and Sky

Latest Posts

  • Shagduk
    November 20, 2022
  • Minimalism
    November 18, 2022
  • Musings on Stories
    November 07, 2022
  • Looking at Thune's Vision
    July 06, 2022
  • Media Gaslighting and Depp
    June 09, 2022
  • Modern Music
    June 08, 2022

Tags

9/11abortionamazonanimeantifaantifragilityappleartbaenbeerblmblogsbooksbullshitcarcastaliacharitychristmascoffeecollegecomcastcomicsconvergencecookingcorreiacrony capitalismcruxshadowsculturediversityeducationelectionempireenergyengineeringentertainmentEuropefakenewsfantasyfascismfeminismfictionfitnessgamergategamesgammageargeneticsgirlsglobalismgooglegothgovernmentgrand tourgunshistoryhomeschoolhumorimmigrationinfogalacticiqisisislamjohn c wrightkidskiplingkylelanguageLarry Correialeftlifestylelinuxmediamemesmenmetalmilitarymiscellanymonster huntermoviemoviesmusicnationniftynightwishnihilismnorwayopen sourcephilosophypodcastspoetrypoliticspowerspressprisonpulpqracerealityreciperegulationreligionresponsibilityreviewringorittenhouseRPGsrussiasabatonsafesatireschlockschoolssciencescience fictionself defensesjwskin in the gamesocialismsolutionsSoundtrackspacestandardsstorytellingtaxesteacherstechtop geartradetravellertrumptruthukraineutopiawarwestwesternwomenxkcd
MeWe OneWay RSS
© 2023
Powered by Ghost. BlogInn theme by JustGoodThemes. Back to the top