Subscribe

Hell Yeah, I'd Get One Too...

Hell Yeah, I'd Get One Too...

Last Redoubt / August 31, 2016

Mildly NSFW but if it’s good enough for our neighborhood preacher and sci-fi/western author, it’s good enough for me:

That said, he was a prison preacher, and a soldier before that….

Share Twitter Facebook Google+
Tags: gearsjw
Last Redoubt's Picture

About Last Redoubt

Post navigation

Next Post Preview
Next

Trump Can Do No Right

August 31, 2016
Previous Post Preview
Previous

What Happens Nextdoor is Racist! (and White Girl Bleed a Lot)

August 31, 2016

Alt Tech

Infogalactic - the Planetary Logic Core

Infogalactic, Gab, and Helping Out

Friends of

  • Castalia House Publishing
  • John C Wright
  • Bayou Renaissance Man
  • Barbarian Book Club
  • Monster Hunter Nation
  • Brian Niemeier
  • Nick Cole
  • Jon Mollison
  • Vox Populi
  • Armed and Dangerous
  • Jefro’s Space Gaming Blog
  • Didact’s Reach
  • Free Domain Radio
  • Stefan Molyneux BitChute
  • Men of the West
  • Dangerous (Milo)
  • Quintus Curtius
  • Stares at the World
  • The Rageaholic
  • Walker’s Retreat
  • Empires Must Fall
  • Wasteland and Sky

Latest Posts

  • Shagduk
    November 20, 2022
  • Minimalism
    November 18, 2022
  • Musings on Stories
    November 07, 2022
  • Looking at Thune's Vision
    July 06, 2022
  • Media Gaslighting and Depp
    June 09, 2022
  • Modern Music
    June 08, 2022

Tags

9/11abortionamazonanimeantifaantifragilityappleartbaenbeerblmblogsbooksbullshitcarcastaliacharitychristmascoffeecollegecomcastcomicsconvergencecookingcorreiacrony capitalismcruxshadowsculturediversityeducationelectionempireenergyengineeringentertainmentEuropefakenewsfantasyfascismfeminismfictionfitnessgamergategamesgammageargeneticsgirlsglobalismgooglegothgovernmentgrand tourgunshistoryhomeschoolhumorimmigrationinfogalacticiqisisislamjohn c wrightkidskiplingkylelanguageLarry Correialeftlifestylelinuxmediamemesmenmetalmilitarymiscellanymonster huntermoviemoviesmusicnationniftynightwishnihilismnorwayopen sourcephilosophypodcastspoetrypoliticspowerspressprisonpulpqracerealityreciperegulationreligionresponsibilityreviewringorittenhouseRPGsrussiasabatonsafesatireschlockschoolssciencescience fictionself defensesjwskin in the gamesocialismsolutionsSoundtrackspacestandardsstorytellingtaxesteacherstechtop geartradetravellertrumptruthukraineutopiawarwestwesternwomenxkcd
MeWe OneWay RSS
© 2023
Powered by Ghost. BlogInn theme by JustGoodThemes. Back to the top